General Information

  • ID:  hor006622
  • Uniprot ID:  P10334
  • Protein name:  Accessory gland-specific peptide 26Ab
  • Gene name:  Acp26Ab
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  Up-regulated in response to mating. |Main cells and secondary cells of the accessory glands of 1 day old virgin males (at protein level) .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007610 behavior; GO:0007617 mating behavior; GO:0019953 sexual reproduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  APFISVQSSSQSRSQKVMNGMLRTLYDYSVQDSVNDATGHLIQTHKADFNSDVMSPDEIESVRQQLNMA
  • Length:  69(22-90)
  • Propeptide:  MNYFAVICIFSCICLWQFSDAAPFISVQSSSQSRSQKVMNGMLRTLYDYSVQDSVNDATGHLIQTHKADFNSDVMSPDEIESVRQQLNMA
  • Signal peptide:  MNYFAVICIFSCICLWQFSDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This protein is transferred from male to female during mating and may affect egglaying and behavior after mating.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10334-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006622_AF2.pdbhor006622_ESM.pdb

Physical Information

Mass: 891860 Formula: C326H519N95O113S4
Absent amino acids: CW Common amino acids: S
pI: 4.81 Basic residues: 7
Polar residues: 22 Hydrophobic residues: 19
Hydrophobicity: -54.2 Boman Index: -15869
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 70.58
Instability Index: 8760.87 Extinction Coefficient cystines: 2980
Absorbance 280nm: 43.82

Literature

  • PubMed ID:  3142802
  • Title:  Structure and expression of a Drosophila male accessory gland gene whose product resembles a peptide pheromone precursor.
  • PubMed ID:  1361475
  • Title:  Polymorphism and divergence in the Mst26A male accessory gland gene region in Drosophila.
  • PubMed ID:  9799260
  • Title:  Different forces drive the evolution of t
  • PubMed ID:  9718731
  • Title:  
  • PubMed ID:  10731132
  • Title:  
  • PubMed ID:  12537572
  • Title:  
  • PubMed ID:  2257979
  • Title: