HORDB

ID: hor006622
Uniprot ID: P10334
Protein name: Accessory gland-specific peptide 26Ab
Gene name: Acp26Ab
Organism: Drosophila melanogaster (Fruit fly)
Family: NA
Source: animal
Expression: Up-regulated in response to mating. |Main cells and secondary cells of the accessory glands of 1 day old virgin males (at protein level) .
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: NA
GO BP: GO:0007610 behavior; GO:0007617 mating behavior; GO:0019953 sexual reproduction
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence: APFISVQSSSQSRSQKVMNGMLRTLYDYSVQDSVNDATGHLIQTHKADFNSDVMSPDEIESVRQQLNMA
Length: 69
Propeptide: MNYFAVICIFSCICLWQFSDAAPFISVQSSSQSRSQKVMNGMLRTLYDYSVQDSVNDATGHLIQTHKADFNSDVMSPDEIESVRQQLNMA
Signal peptide: MNYFAVICIFSCICLWQFSDA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: This protein is transferred from male to female during mating and may affect egglaying and behavior after mating.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006622_AF2.pdb

hor006622_ESM.pdb

Mass:	891860	Formula:	C326H519N95O113S4
Absent amino acids:	CW	Common amino acids:	S
pI:	4.81	Basic residues:	7
Polar residues:	22	Hydrophobic residues:	19
Hydrophobicity:	-54.2	Boman Index:	-15869
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	70.58
Instability Index:	8760.87	Extinction Coefficient cystines:	2980
Absorbance 280nm:	43.82

PubMed ID: 3142802
Title: Structure and expression of a Drosophila male accessory gland gene whose product resembles a peptide pheromone precursor.
PubMed ID: 1361475
Title: Polymorphism and divergence in the Mst26A male accessory gland gene region in Drosophila.
PubMed ID: 9799260
Title: Different forces drive the evolution of the Acp26Aa and Acp26Ab accessory gland genes in the Drosophila melanogaster species complex.
PubMed ID: 9718731
Title: Positive selection driving the evolution of a gene of male reproduction, Acp26Aa, of Drosophila: II. Divergence versus polymorphism.
PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 2257979
Title: Synthesis of two Drosophila male accessory gland proteins and their fate after transfer to the female during mating.